FGF-21 Protein, Human
SKU: 1343191760

FGF-21 Protein, Human

Sale price$122.40 Regular price$136.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGF-21 Protein, HumanProduct Specification Species Human Synonyms Fibroblast growth factor 21 Accession Q9NSA1 Amino Acid Sequence His29 Ser209, with N terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Expression System E. coli Molecular Weight 25 kDa(Reducing) Purity 97% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Fibroblast growth factor 21
Accession Q9NSA1
Amino Acid Sequence

His29-Ser209, with N-terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Expression System E.coli
Molecular Weight

25 kDa(Reducing)

Purity

>97% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM Tris, 100mM NaCl, pH7.5

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Fibroblast growth factor 21 (FGF-21) is a pleiotropic hormone considered as a major regulator of energy homeostasis. FGF-21 is mainly secreted by the liver, but it may also be expressed in skeletal muscle. In this sense, FGF-21 protein expression is induced by insulin in C2C12 myocytes, and FGF21 mRNA is upregulated by hyperinsulinemia in skeletal muscle in young healthy men. Moreover, it has been suggested that FGF-21 is a signal secreted by the skeletal muscle to communicate with adipose tissue under stress conditions. FGF21 has been shown to be a major regulator of hepatic lipid metabolism, with FGF-21 overexpressing mice being resistant to diet-induced obesity. Interestingly, recent studies suggest that FGF21 may exert anti-inflammatory actions in the pancreas, heart, and skeletal muscle. A reduction in the JNK and NF-κB signaling pathways has been proposed as the potential mechanism implicated in the FGF-21 anti-inflammatory effects.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1343191760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 876 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kathleen G. Bohle
Los Angeles, US
★★★★★ 5
Exceptional
Format: Kindle
I think this an exciting entertaining story different from other fantasy reverse harmen story. I love the 1st book in this series and hope it continues to weave a story of friendship, love and disappointment as well as sadness. The cliffhanger was gripping and held you in suspense that waiting until the next book was released was almost too much. I’m so glad I waited to read this series until the majority of the books were released. Katie May and Quinn Arthur’s are wonderful writers and I’m looking forward to reading more from both of them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2025
J
Verified Purchase
Johanna J
San Leandro, US
★★★★★ 3
I don’t mind a cliffhanger,
Format: Kindle
but I dropped at least one star because of the obnoxious gloating of the author after the cliffhanger. Seriously - I don’t understand making your readers angry because you’re smug and expecting them to keep reading your books. I was very definitely enjoying the series. Now I have a bad taste in my mouth and mixed feelings about continuing the series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2025
S
Verified Purchase
Stephen Wiggs
Waukegan, US
★★★★★ 4
The series as a whole so far 5/25
Format: Kindle
I read reviews before going into this book and I don't agree with one of the more harsh ones on the main trigger she had. It is stated clearly in the forward and it wasn't as blase as it was made out to be. It definitely is touched on more and hasn't just been brushed off as the series goes I definitely would recommend reading it. It's a good series just be for-warned I like the series as a whole. The characters are awesome I adore the fmc shes cute and adorable but also a badass. Though there are a bunch of holes for her that I feel like just got left out. The guys are interesting and shout out to yall for not making Gage a dragon. I'm tired of the broody ones who don't wanna talk aboit what they are being Dragons. Ki is my favorite You can definitely tell if is written by 2 different people though because the phrasing just doesn't match up and wouldn't be something people that age says. And it flip flops between them. I feel like there's substance without substance. We are 4 books in and we don't really know much back story on literally anyone more than right under surface deep. There are definitely favorite MMCs which is kind of disappointing since some get shoved to the wayside. Specifically both of the best friends. They're basically useless and it's made obvious as the books go on. As well as all the men are ungodly self deprecating. I enjoy the plot line for the most part like I said I enjoy the series its different and refreshing. I do feel like the series is being dragged out though unfortunately. And the latest cliff hanger was just meh. So hopefully the next book is the last one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2025
O
Verified Purchase
Oohlala857
Alexandria, US
★★★★★ 5
Wow!
Format: Kindle
This book was awesome! Seraphina and her family have moved to a new town. Her family is a bit... odd. She grew up learning how to protect herself from people who might hurt her. Bloodshed is a daily occurrence with her brothers and parents during their practice sessions, and it’s all fun and games unless you need to hide a body. Sera’s family is very close, and she’s been homeschooled most of her life. But in this new town she is going to start regular school as a senior at the local high school. Unfortunately, things at her school aren’t all they seem to be. Or perhaps more than they seem to be. Sera has her own demons to deal with, and she’s terrified her new friends will learn about her weird family and other issues and drop her like a rock. It turns out they have their own secrets as well. This story ends on a bit of a cliffhanger and I can’t wait to read the next one! This book is well written and well edited. The heroine is spunky and has a great heart and wicked sense of humor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2021
K
Verified Purchase
Kayla Cercone
Omaha, US
★★★★★ 5
No Mourners..
Format: Hardcover
‘No mourners…’ ‘…no funerals.’ Among them, it passed for good luck. ” This quote is a perfect description of the tone set throughout this entire novel. A hopelessness so ingrained in a group of people that their phrase for good luck is hinged around the idea of no one mourning or honoring their deaths. Having read the Shadow and Bone trilogy, I was familiar with the Grisha universe prior to reading this novel. If you’re wondering which you should read first, I suggest reading the trilogy prior to the duology — it will get you a lot of historical context that lays the foundation for the problems, war and ultimate state of the world this book is set it. I will say, I enjoyed the Grisha trilogy but found myself frustrated with the direction the story ended up going. Leigh Bardugo is a phenomenal writer but it felt like the end of that trilogy took the easy way out — but that review is for a different day. Six of crows shows Bardugo’s redemption in making the difficult but correct plot choices, in my opinion. This entire book is thrilling because the reader (presumably having read her previous Grisha trilogy) goes into the story assuming they will have some idea of where the story will go, having explored this world before. This couldn’t be farther from the truth. Six of crows follows the dark and dangerous mob-lifestyles in the Barrel of Ketterdam, far away from the Golden Palace of Prince Nikolai and the worshiped Sankta Alina. Bardugo does not shy away from the dark and gruesome reality of the mob lifestyle, she embraces it. Readers are shown vivid descriptions of call-girls, gambling rings, mistakes punishable by death and ruthless leaders capable of lethality at any second. Despite such a horrific environment, Bardugo’s character development leaves the readers connecting, loving and rooting for characters with truly horrible qualities. One thing I appreciated was the pacing of this story – you’re shown an enticing and mysterious scene right off the bat, completely immersing you into this story as you crave to find out more behind what happened. Immediately, you’re pulled away and shown the humble beginnings of Kas Brekker and the Dregs from the Crow Club, learning about their personalities, roles, and motives for the dangerous job that takes up most of the story. Readers learn details slowly — not so slow that they’re bored — but slow enough that they’re kept hooked to the plot, hoping the next page turn will provide the answer they need. Just when you might become a bit bored by the plot, a twist or exciting, unexpected wrench gets thrown into the mix bringing you back in. As you go along in the story, you’re introduced to more details about each member of the Dregs, their pasts that led them to this journey they take together, and the secrets that shape their relationships. These details are done brilliantly, as readers are able to see these memories and experiences from each characters point of view. This brings a human quality to the characters and allows readers to empathize with their situations, thus creating a bond between reader and character that allows them to continue to love and support the Dregs despite the horrible things they do to each other and others throughout the journey. You’re rooting for them to get the endings they want and deserve and hoping they won’t choose to lie, cheat, kill and steal in order to get there, but ultimately accept that that is just who they are. The only time this aspect of the characters was frustrating was at the end of the book. The relationship between Kaz and Inej is tantalizingly frustrating throughout the story, but the end of the book is where we really see Kaz’s nature and I found myself so frustrated that he couldn’t be better for her and that because of him, Inej gets placed in the worst case scenario. I’m hoping that he redeems himself in the second installment. Overall — there’s no denying that Leigh Bardugo has talent and if you loved the first trilogy, I guarantee you’ll love this one even more. If you had mixed feelings on the first Grisha trilogy, I urge you to give this duology a try. I think you’ll be pleasantly surprised. Stay tuned for the review around book two!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2017

recommand products